DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and LOC101730581

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_031758232.1 Gene:LOC101730581 / 101730581 -ID:- Length:166 Species:Xenopus tropicalis


Alignment Length:167 Identity:58/167 - (34%)
Similarity:88/167 - (52%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKYERILSDCRSKNVLWEDPDFPAVQSSVFYYQTPPFTFQWKRIMDLADSGSGAVAANSSAAP 65
            :...||::.:.|...|..:||.:|||.|:|:   ......|.|.|..::..:            |
 Frog    15 LGQDYEQLRAQCLPPNPPFEDKEFPASQASL---GPKKQGFVWLRPSEIHPN------------P 64

  Fly    66 VFLNESA-EFDVVPGKMGDRWLVSCLGLLSSLRNLFYRVVPADQTLASAH-GVFRFRLWWCGEWV 128
            .|:...| .||:....:||.|.:|.:|.|:..:.....|||.||:..:.: |:|.||.|..|:|.
 Frog    65 EFITSGATRFDICQQGLGDCWFLSPMGCLTLNKEYLSLVVPQDQSFKTNYAGIFHFRFWQRGDWT 129

  Fly   129 EVLVDDRLPTINGRLAFMQPQASNCFWAALLEKAIAK 165
            :|:|||:|||.:.:|.|::....|.|||||||||.||
 Frog   130 DVVVDDKLPTKDKKLVFVKSAEENEFWAALLEKAFAK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004 56/161 (35%)
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455
LOC101730581XP_031758232.1 CysPc 33..>166 CDD:412132 52/147 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.