DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpC and gca

DIOPT Version :9

Sequence 1:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001119547.1 Gene:gca / 100125139 XenbaseID:XB-GENE-983090 Length:203 Species:Xenopus tropicalis


Alignment Length:137 Identity:38/137 - (27%)
Similarity:72/137 - (52%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ELLEACLPNDYIKGC---ANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEK 598
            |.|:.||....|:|.   .:::.||.:||:.||..:|::.|.:||.....|.:|:..|..:.:::
 Frog    57 EELQRCLTQAGIQGTYTPFSLETCRVLIAMLDRDFTGKMGFSEFKEVWGALSAWKQNFCTFDQDR 121

  Fly   599 AGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIH---LTTAFNQFHLKN 660
            :|.:....|..|:..:|::||...::.:::|| .|:|.:...|:|:..:.   ||..|.:.....
 Frog   122 SGTVEPHELNQAIFAMGYRLSPPTLSTIVKRY-SKNGRIYFDDYVACCVKLRALTDVFRRRDGMQ 185

  Fly   661 YGQVNVI 667
            .|.||.|
 Frog   186 QGFVNFI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455 19/80 (24%)
gcaNP_001119547.1 EFh_PEF_grancalcin 39..203 CDD:320061 38/137 (28%)
EF-hand motif 39..67 CDD:320061 4/9 (44%)
EF-hand motif 79..108 CDD:320061 10/28 (36%)
EF-hand motif 109..139 CDD:320061 5/29 (17%)
EF-hand motif 145..172 CDD:320061 6/27 (22%)
EF-hand motif 173..203 CDD:320061 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.