DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CPR2

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:92/163 - (56%)
Similarity:110/163 - (67%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCT---GEKGFGYKGSIFHRVIPNFMCQGGD 129
            :||||:....|.:||||:.|...|.||||:||..|.|   .:|||  .||.|||||||||.||||
Yeast    37 KVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGF--IGSTFHRVIPNFMVQGGD 99

  Fly   130 FTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTA-WLDNKHVVFG 193
            ||:..|.|||||||:.||||||.|||...|.|||||.|.:||||||||.|.:.| |||.||||||
Yeast   100 FTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFG 164

  Fly   194 EVVEGLDVVKKIESYGSQSG-KTSKKIIVANSG 225
            :||:|:|||..|:.....:. |..:.:.:|..|
Yeast   165 QVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 91/161 (57%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 91/161 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.