DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CPR8

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:45/170 - (26%)
Similarity:75/170 - (44%) Gaps:31/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSI---------------FHR 118
            ||.|..:..|....|.::|...:||||...|   |.      |..|:               |.:
Yeast    55 VFTDPESSEEAGRLITIDLYGTMVPKTVMTF---CQ------YVDSVKDRLASRHSYSPERDFDK 110

  Fly   119 VIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTA 183
            ::||...:|...:: :......:...|.|:||..|.|...|.:||..   :..|.:|.|.|.:|.
Yeast   111 ILPNGAIEGSSVSS-SSIEETEMLAPKLPEENHSLIHDRPGRVSMIK---DDKGLKFIIETSETP 171

  Fly   184 WLDNKHVVFGEVVEGL-DVVKKIESYGS-QSGKTSKKIIV 221
             |:.:.||||:|..|| |::.|:.:..: ::||..:.|.:
Yeast   172 -LEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 45/170 (26%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.