DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CPR3

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:110/178 - (61%)
Similarity:131/178 - (73%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IQIVREYS-KASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGS 114
            ||..|.:| .||::.  .:||||...:...:|||..||..:||||||||||||||||||:||||.
Yeast     7 IQQSRLFSNSASRLG--KKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGV 69

  Fly   115 IFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICT 179
            .|||:||:||.||||....||.|||||||:||.||||..||..:|:|||||||.|||||||||.|
Yeast    70 PFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITT 134

  Fly   180 VKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            |...|||.||||||||.:|:|:||.|||||:.|||...:|::..:|.|
Yeast   135 VPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 102/157 (65%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 102/156 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm9218
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X209
TreeFam 1 0.960 - -
87.600

Return to query results.
Submit another query.