DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CPR5

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_010590.3 Gene:CPR5 / 851898 SGDID:S000002712 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:90/162 - (55%)
Similarity:112/162 - (69%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RVFFDMTADNEPLGRIVMELRSDVVPKTAENFRAL-CTGEKGFGYKGSIFHRVIPNFMCQGGDFT 131
            :|:||:...::.:|||||.|.....|:|.|||..| .:.:...||..|||||||||||.||||||
Yeast    35 KVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFT 99

  Fly   132 NHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVV 196
            :.:|.|||||:||.|.||||::||...|.|||||.|.|||||||||.||...|||.||||||||:
Yeast   100 HRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVL 164

  Fly   197 EGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            :|:|||..||:..:.| ....|::|:..||.|
Yeast   165 DGMDVVHYIENVKTDSRNMPVKEVIIVESGEL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 87/158 (55%)
CPR5NP_010590.3 cyclophilin 34..194 CDD:412213 87/158 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.