DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CPR1

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:114/162 - (70%)
Similarity:132/162 - (81%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDF 130
            :.:|:||:.||.:|:||:|.:|.:|:||||||||||||||||||||.||.||||||:||.|||||
Yeast     1 MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDF 65

  Fly   131 TNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            |..||||||||||.|||||||:..|...|:|||||||.|||||||||.||...|||.||||||||
Yeast    66 TAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEV 130

  Fly   196 VEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            |:|.|:|||:||.||.||.|..:|:||.||.|
Yeast   131 VDGYDIVKKVESLGSPSGATKARIVVAKSGEL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 111/157 (71%)
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 111/157 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343456
Domainoid 1 1.000 232 1.000 Domainoid score I402
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 1 1.050 242 1.000 Inparanoid score I686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm9218
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
TreeFam 1 0.960 - -
1312.680

Return to query results.
Submit another query.