DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ROC7

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_200679.1 Gene:ROC7 / 835985 AraportID:AT5G58710 Length:204 Species:Arabidopsis thaliana


Alignment Length:177 Identity:108/177 - (61%)
Similarity:130/177 - (73%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSI 115
            ||.:......:|:||:..|.:..|||||.|....||||.||||||||||||.|       ||||.
plant    26 SKENLKEITHKVYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSS 90

  Fly   116 FHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTV 180
            |||:||:||.||||||:.||.||:||||.||.||||:|||||.|.|||||||.:||||||||.||
plant    91 FHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTV 155

  Fly   181 KTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            .|:|||.:|||||:||.|:|||.|:|:.|:|||....|:::.:||.|
plant   156 TTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 103/164 (63%)
ROC7NP_200679.1 cyclophilin_ABH_like 35..200 CDD:238907 103/164 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.