DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and AT4G34960

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:184 Identity:89/184 - (48%)
Similarity:125/184 - (67%) Gaps:14/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKG-------F 109
            |::.::...:      |||.|:..|.:.|||||:.|...|||||.||||||||||||       .
plant    38 QVIEDHEITN------RVFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPL 96

  Fly   110 GYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQ 174
            .|||:.|||:|..|:.||||..:.:|....||||..||||||:::|:.:|:::|||.|.::||||
plant    97 HYKGTPFHRIISGFVIQGGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTGPDSNGSQ 161

  Fly   175 FFICTVKTAWLDNKHVVFGEVVEGLDVVKKIE-SYGSQSGKTSKKIIVANSGSL 227
            |||.|||.:||:.:|||.|:|::|:|.|..|| ..|:.|||..||:::|:||.:
plant   162 FFITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 86/165 (52%)
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 86/164 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.