DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ROC5

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_195213.1 Gene:ROC5 / 829639 AraportID:AT4G34870 Length:172 Species:Arabidopsis thaliana


Alignment Length:168 Identity:119/168 - (70%)
Similarity:132/168 - (78%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSIFHRVIPNFM 124
            |||||||:....|:|||.|||.:|..|.||||||||||||||.|       :||||||||||.||
plant     4 PRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIFHRVIPGFM 68

  Fly   125 CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKH 189
            |||||||..|||||:||||.||.||||..||||:|||||||:|.|||||||||||.||:|||.||
plant    69 CQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDGKH 133

  Fly   190 VVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||||:||:||||||.||..||.||||||.:.:.:.|.|
plant   134 VVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 117/164 (71%)
ROC5NP_195213.1 cyclophilin_ABH_like 4..169 CDD:238907 117/164 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 245 1.000 Domainoid score I551
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I999
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm1140
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.