DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and AT4G32420

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001190889.1 Gene:AT4G32420 / 829377 AraportID:AT4G32420 Length:837 Species:Arabidopsis thaliana


Alignment Length:167 Identity:76/167 - (45%)
Similarity:105/167 - (62%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG--------YKGSIFHRVIPNF 123
            |:||.|::.|.:|...:|.||..:|.|||:||||||||||||.|        ||||.|||::...
plant     7 PQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRIMKGS 71

  Fly   124 MCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNK 188
            ..|.|||.|.|||.|:|||..|||||:.:|:|..:|:|||:.|..:..||.|.|.......||..
plant    72 SAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHFHITFRPNQQLDRN 136

  Fly   189 HVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSG 225
            :||||::::|.:::||||..|.:.||.:..:.:...|
plant   137 NVVFGKLIQGKEILKKIERVGDEEGKPTVSVKIIRCG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 75/165 (45%)
AT4G32420NP_001190889.1 cyclophilin 7..173 CDD:381853 75/165 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.