DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ROC4

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001154684.1 Gene:ROC4 / 825376 AraportID:AT3G62030 Length:313 Species:Arabidopsis thaliana


Alignment Length:167 Identity:105/167 - (62%)
Similarity:127/167 - (76%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIF 116
            :::...:|.:.     :|:||:....|..|||||.|..:|||||.|||||||||||.:|||||.|
plant   138 EVIEPQAKVTN-----KVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSF 197

  Fly   117 HRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVK 181
            ||:|.:||.||||||..|||||.||||.||.||||.|||||.|||||||||.|||||||||||||
plant   198 HRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVK 262

  Fly   182 TAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKK 218
            |:||||||||||:|:||:.:|:.:||..:::....||
plant   263 TSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 104/152 (68%)
ROC4NP_001154684.1 cyclophilin_ABH_like 149..307 CDD:238907 104/151 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.