DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and AT3G22920

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_188932.1 Gene:AT3G22920 / 821864 AraportID:AT3G22920 Length:232 Species:Arabidopsis thaliana


Alignment Length:173 Identity:78/173 - (45%)
Similarity:106/173 - (61%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSIFHRVIPNFM 124
            |:||||:|.|.:|.||||:||.:|:.|:||||||.|||||:|.|       ||||.|..::|:.|
plant     4 PKVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTFDHIVPDLM 68

  Fly   125 CQGGDFTNHNGTGGKSIYGNKFPDENFELKH-TGSGILSMANAGANTNGSQFFICTVKTAWL--D 186
            ..|||....|    :.|:..:..||.|.|.| .|.||:||    |::|||||.| .:|...|  |
plant    69 WCGGDIIFEN----EPIHSEELDDEYFILNHEDGPGIISM----ADSNGSQFQI-HMKDYGLQVD 124

  Fly   187 NKHVVFGEVVEGLDVVKKIES--YGSQSGKTSKKIIVANSGSL 227
            ..|||.|:||||||:::.||.  ..:.:...||.:::|:.|.|
plant   125 GDHVVIGKVVEGLDLMRNIEKEVITTTTRTPSKPVVIADCGEL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 76/169 (45%)
AT3G22920NP_188932.1 cyclophilin 1..168 CDD:381853 78/173 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.