DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and AT2G38730

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:168 Identity:90/168 - (53%)
Similarity:112/168 - (66%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGE-----KGFGYKGSIFHRVIPNFMCQ 126
            |.||||::....|.|||.|||.:|:.||||||||..||||     |..|||...|||||.:||.|
plant    32 PVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKPLGYKECQFHRVIKDFMVQ 96

  Fly   127 GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVV 191
            .|||..::|:|..||||:||.||||..||||.|:|||||:|.||||.||||...|..||||||||
plant    97 SGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVV 161

  Fly   192 FGEVV-EGLDVVKKIESYG-SQSGKTSKKIIVANSGSL 227
            ||.|: :||.|::|||:.. ..:.:....:::...|.:
plant   162 FGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 89/164 (54%)
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 90/166 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.