DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CYP5

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001318316.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:167 Identity:106/167 - (63%)
Similarity:130/167 - (77%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSIFHRVIPNFMC 125
            :|:||:..|.:..||:|:.|....|||||||||||||||||.|       ||||.|||:||:||.
plant    33 KVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI 97

  Fly   126 QGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHV 190
            ||||||:.||.||:||||.||.||||:|||||.|:|||||:|.:||||||||.||.|:|||.:||
plant    98 QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLDGRHV 162

  Fly   191 VFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            |||:||:|:|||.|||:.|.|||....|:::|:||.|
plant   163 VFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 103/163 (63%)
CYP5NP_001318316.1 cyclophilin_ABH_like 32..197 CDD:238907 103/163 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.