DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppil4

DIOPT Version :10

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_080417.2 Gene:Ppil4 / 67418 MGIID:1914668 Length:492 Species:Mus musculus


Alignment Length:135 Identity:55/135 - (40%)
Similarity:77/135 - (57%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGN 144
            ||.:|::|.::..|:...||..||   |...|...:.|.|..:|:.|.||.|. .|.||:||:|.
Mouse     9 LGDVVIDLYTEERPRACLNFLKLC---KIKYYNYCLIHNVQRDFIIQTGDPTG-TGRGGESIFGQ 69

  Fly   145 KFPDEN--FE------LKHTGSGILSMANAGANTNGSQFFICTVKTA-WLDNKHVVFGEVVEGLD 200
            .:.|:.  ||      :||...|.:||.|.|::.:||||.|.|.:.. :||..|.|||||.||:|
Mouse    70 LYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMD 134

  Fly   201 VVKKI 205
            :||||
Mouse   135 IVKKI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 55/135 (41%)
Ppil4NP_080417.2 cyclophilin_RRM 4..161 CDD:238902 55/135 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..188
RRM_PPIL4 237..319 CDD:409681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..409
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..492
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.