DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIAL4D

DIOPT Version :10

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001157733.1 Gene:PPIAL4D / 645142 HGNCID:33998 Length:164 Species:Homo sapiens


Alignment Length:157 Identity:107/157 - (68%)
Similarity:125/157 - (79%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNH 133
            |||::|.|.:|||||.::|.:|.:||||||||||.||||||.||||.|||:||.|||||||||..
Human     6 VFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRP 70

  Fly   134 NGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEG 198
            ||||.|||||.||.|||...||||||||||||||.||||||||||..||.|||.|||.||:|.|.
Human    71 NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKER 135

  Fly   199 LDVVKKIESYGSQSGKTSKKIIVANSG 225
            :::|:..|.:|.::.||||||.:|:.|
Human   136 VNIVEATEHFGYRNSKTSKKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 106/155 (68%)
PPIAL4DNP_001157733.1 cyclophilin 4..162 CDD:469651 106/155 (68%)

Return to query results.
Submit another query.