DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppib

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:179 Identity:102/179 - (56%)
Similarity:130/179 - (72%) Gaps:3/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGS 114
            |..:..:..|..|::.  :|:||....:||:||:...|....||||.:||.||.|||||||||.|
  Rat    21 GPSVANDKKKGPKVTV--KVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNS 83

  Fly   115 IFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICT 179
            .|||||.:||.||||||..:|||||||||.:||||||:|||.|.|.:||||||.:||||||||.|
  Rat    84 KFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITT 148

  Fly   180 VKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            |||:|||.||||||:|:||:|||:|:|:..:.| .|..|.:|:.:.|.:
  Rat   149 VKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 98/158 (62%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 98/157 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.