DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppifb

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:201 Identity:132/201 - (65%)
Similarity:153/201 - (76%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILANKSITLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDV 91
            ||.|:     ...|||       .....|.||...:.:..|.||||:.|||:||||:..||.:||
Zfish     3 ILGNR-----LKLCSV-------AFTAARLYSTGVQANNNPVVFFDIAADNQPLGRVTFELNADV 55

  Fly    92 VPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHT 156
            |||||||||||||||.||||||||||||||.|||||||||||||||||||||.:||||||:||||
Zfish    56 VPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFTNHNGTGGKSIYGPRFPDENFKLKHT 120

  Fly   157 GSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIV 221
            |.|||||||||.|||||||||||.||.|||.:|||||.|.||:|||:|:|:.||:||:|:::|.:
Zfish   121 GPGILSMANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVKEGMDVVRKVEALGSRSGRTAQRISI 185

  Fly   222 ANSGSL 227
            .:.|.|
Zfish   186 TDCGEL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 121/157 (77%)
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 121/157 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 261 1.000 Domainoid score I1920
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.