DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppie

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:166 Identity:114/166 - (68%)
Similarity:134/166 - (80%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 124
            |.|..:.|:|:.|:...|:|.|||.|.|||||||.||||||.|||.|||||:|||.|||:||.||
Mouse   133 AKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFM 197

  Fly   125 CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKH 189
            |||||||||||||||||||.||.||||.|||||.|:|||||:|.||||||||:...||.|||.||
Mouse   198 CQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKH 262

  Fly   190 VVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSG 225
            ||||||.|||||:::||:.||:.||..:|:::|:.|
Mouse   263 VVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 111/157 (71%)
PpieNP_062362.1 RRM <5..194 CDD:223796 38/60 (63%)
RRM_PPIE 8..80 CDD:240793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141 2/7 (29%)
cyclophilin_ABH_like 140..298 CDD:238907 111/157 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.