DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppil6

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:147 Identity:76/147 - (51%)
Similarity:98/147 - (66%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKG-------FGYKGSIFHRVIPNFMCQ 126
            |:.|:....|.:||::.||.|||.|||..||:||||||.|       ..||||:||||:||...|
Zfish   125 VYMDIENGGEAVGRLLFELFSDVCPKTCRNFKALCTGEAGLSKSNLELSYKGSVFHRVVPNGWIQ 189

  Fly   127 GGDFT-NHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHV 190
            |||.: ...||||:||||..|.||||.:.|...|||.|||.||::|||||:|......|:|.|:|
Zfish   190 GGDISPEKKGTGGESIYGPTFEDENFVISHNKRGILGMANQGAHSNGSQFYITLQPATWMDQKYV 254

  Fly   191 VFGEVVEGLDVVKKIES 207
            .||::.||.||:|::|:
Zfish   255 AFGQLAEGTDVLKRLEA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 76/147 (52%)
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 76/147 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.