DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppib

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017063.1 Gene:ppib / 549817 XenbaseID:XB-GENE-855964 Length:208 Species:Xenopus tropicalis


Alignment Length:194 Identity:105/194 - (54%)
Similarity:137/194 - (70%) Gaps:7/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ACSVNRGQLQF----GIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENF 99
            |.::..|.:.|    |..:..|..|..|::  .:|:||:...:|.:||:|:.|....||||.|||
 Frog     6 AAALIAGSVIFLLFPGSSVADEKKKGPKVT--HKVYFDIKIGDEDVGRVVIGLFGKTVPKTVENF 68

  Fly   100 RALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMA 164
            ..|.|||||||||||.|||||.:||.||||||..:|||||||||::||||||:|:|.|...:|||
 Frog    69 VTLATGEKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLRHYGPNWVSMA 133

  Fly   165 NAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            |||.:||||||||.||||.|||.||||||:::||.|||:||||..:.. .|..|.:::|:.|::
 Frog   134 NAGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGKDVVEKIESTKTDGRDKPLKDVVIADCGTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 97/158 (61%)
ppibNP_001017063.1 cyclophilin_ABH_like 36..195 CDD:238907 97/158 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.