DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIC

DIOPT Version :10

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_000934.1 Gene:PPIC / 5480 HGNCID:9256 Length:212 Species:Homo sapiens


Alignment Length:167 Identity:98/167 - (58%)
Similarity:117/167 - (70%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 STLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGG 128
            |...:||||:...::.:||||:.|...|||||.|||.||.|||||:|||||.|||||.:||.|||
Human    35 SVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGG 99

  Fly   129 DFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFG 193
            |.|..:||||.||||..||||||:|||.|.|.:||||||.:||||||||...|..|||.||||||
Human   100 DITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFG 164

  Fly   194 EVVEGLDVVKKIE---SYGSQSGKTSKKIIVANSGSL 227
            :|::|:.||..||   :.|.....|:..||  |||.:
Human   165 KVIDGMTVVHSIELQATDGHDRPLTNCSII--NSGKI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 95/160 (59%)
PPICNP_000934.1 cyclophilin 39..197 CDD:469651 95/159 (60%)

Return to query results.
Submit another query.