DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIB

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_000933.1 Gene:PPIB / 5479 HGNCID:9255 Length:216 Species:Homo sapiens


Alignment Length:203 Identity:109/203 - (53%)
Similarity:141/203 - (69%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NKSITLASSACSVNRGQLQF----GIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSD 90
            |..:.||::..:   |.:.|    |.....|..|..|::.  :|:||:...:|.:||::..|...
Human     8 NMKVLLAAALIA---GSVFFLLLPGPSAADEKKKGPKVTV--KVYFDLRIGDEDVGRVIFGLFGK 67

  Fly    91 VVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKH 155
            .||||.:||.||.|||||||||.|.|||||.:||.||||||..:|||||||||.:||||||:|||
Human    68 TVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKH 132

  Fly   156 TGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKI 219
            .|.|.:||||||.:||||||||.||||||||.||||||:|:||::||:|:||..:.| .|..|.:
Human   133 YGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDV 197

  Fly   220 IVANSGSL 227
            |:|:.|.:
Human   198 IIADCGKI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 99/158 (63%)
PPIBNP_000933.1 cyclophilin_ABH_like 45..203 CDD:238907 99/157 (63%)
Prevents secretion from ER 213..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.