Sequence 1: | NP_523366.2 | Gene: | Cyp1 / 32595 | FlyBaseID: | FBgn0004432 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000933.1 | Gene: | PPIB / 5479 | HGNCID: | 9255 | Length: | 216 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 109/203 - (53%) |
---|---|---|---|
Similarity: | 141/203 - (69%) | Gaps: | 10/203 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 NKSITLASSACSVNRGQLQF----GIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSD 90
Fly 91 VVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKH 155
Fly 156 TGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKI 219
Fly 220 IVANSGSL 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cyp1 | NP_523366.2 | cyclophilin_ABH_like | 67..225 | CDD:238907 | 99/158 (63%) |
PPIB | NP_000933.1 | cyclophilin_ABH_like | 45..203 | CDD:238907 | 99/157 (63%) |
Prevents secretion from ER | 213..216 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53630 | |
OrthoDB | 1 | 1.010 | - | - | D1403619at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000032 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.830 |