DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIL3

DIOPT Version :10

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens


Alignment Length:141 Identity:53/141 - (37%)
Similarity:73/141 - (51%) Gaps:27/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGRIVMELRSDVVPKTAENFRALCTGEKGF-------------GYKGSIFHRVIPNFMCQGGDFT 131
            :|.|.:|:..:..|||.| ..:.|..:.|.             |:| .:|...:|          
Human     9 VGDIKIEVFCERTPKTCE-MESRCVPQAGVQWRDLGSLQPPPPGFK-QVFCLSLP---------- 61

  Fly   132 NHNGTGGKSIYGNKFPDENFE-LKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
             ..|.||.||:|.||.||..| |||...|::||||.|.|||||||||...|...||.|:.|||:|
Human    62 -RTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKV 125

  Fly   196 VEGLDVVKKIE 206
            ::||:.:.::|
Human   126 IDGLETLDELE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 53/141 (38%)
PPIL3NP_115861.1 cyclophilin 1..158 CDD:469651 53/141 (38%)

Return to query results.
Submit another query.