DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIL1

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:140 Identity:67/140 - (47%)
Similarity:91/140 - (65%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFT 131
            |.|:.:.:     :|.||:||.....|||.:||..|  ..:|: |.|:.|||:|.:||.||||.|
Human    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY-YNGTKFHRIIKDFMIQGGDPT 68

  Fly   132 NHNGTGGKSIYGNKFPDE-NFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            . .|.||.||||.:|.|| :.:||.||:|||:|||||.:|||||||:....|.|||.||.:||.|
Human    69 G-TGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   196 VEGLDVVKKI 205
            .:|:.:|.::
Human   133 CQGIGMVNRV 142

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 67/140 (48%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 65/137 (47%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 6/10 (60%)