DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppif

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:172 Identity:126/172 - (73%)
Similarity:149/172 - (86%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ASKMSTLPR----VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVI 120
            :|..|.||:    |:.|:.|||:||||:..|||:|||||||||||||||||||||||||.|||:|
 Frog    28 SSDWSGLPKKNPMVYMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRII 92

  Fly   121 PNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWL 185
            |||||||||||||||||||||||::||||||.|||||.|::||||||.||||||||||||:|.||
 Frog    93 PNFMCQGGDFTNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFICTVETEWL 157

  Fly   186 DNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||||||||.:.:|.|::|||||:||::|:.|||::||..|.|
 Frog   158 DNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 121/161 (75%)
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 120/157 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 263 1.000 Domainoid score I1897
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 1 1.050 275 1.000 Inparanoid score I2886
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm72284
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.