DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and NKTR

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001336053.1 Gene:NKTR / 4820 HGNCID:7833 Length:1463 Species:Homo sapiens


Alignment Length:149 Identity:82/149 - (55%)
Similarity:103/149 - (69%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG--------YKGSIFHRVIPNF 123
            |:..||:..:.||:|||:.:|.||:.|||.:||..||:||||.|        ||||.||||:.||
Human     7 PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNF 71

  Fly   124 MCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNK 188
            |.|||||:..||.||:||||..|.||||.|||..:.:|||||.|.:||||||||.|.....||..
Human    72 MIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGV 136

  Fly   189 HVVFGEVVEGLDVVKKIES 207
            |||||.|:.|.:|:::||:
Human   137 HVVFGLVISGFEVIEQIEN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 82/149 (55%)
NKTRNP_001336053.1 cyclophilin 7..174 CDD:320812 82/149 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..1072
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1129..1156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1169..1215
Arg/Ser tandem repeat-rich 1311..1348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.