DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppil1

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001005007.1 Gene:ppil1 / 448493 XenbaseID:XB-GENE-963801 Length:166 Species:Xenopus tropicalis


Alignment Length:140 Identity:64/140 - (45%)
Similarity:86/140 - (61%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFT 131
            |.|..:.:     :|.|.:||.....|.|.:||..|  ..:|: |.|:.|||:|.:||.||||.|
 Frog    12 PHVLLETS-----MGTITVELYWLHAPMTCKNFAEL--ARRGY-YNGTKFHRIIKDFMVQGGDPT 68

  Fly   132 NHNGTGGKSIYGNKFPDE-NFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            . .|.||.||||.:|.|| :.:||.||:|||:|||||.::||||||:....|.|||.||.:||.|
 Frog    69 G-TGRGGASIYGKQFEDEIHPDLKFTGAGILAMANAGPDSNGSQFFLTLAPTQWLDGKHSIFGRV 132

  Fly   196 VEGLDVVKKI 205
            ..||..:.::
 Frog   133 SHGLGTLNRL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 64/140 (46%)
ppil1NP_001005007.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 62/137 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.