DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppib

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_998184.1 Gene:ppib / 406292 ZFINID:ZDB-GENE-040426-1955 Length:216 Species:Danio rerio


Alignment Length:228 Identity:111/228 - (48%)
Similarity:143/228 - (62%) Gaps:24/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSFCATLIRQFRHRSAAAFQIAESAILANKSITLASSACSVNRGQLQFGIQIVREYSKASKMST 65
            ||..|...::         |.:|.:.|:.:....|..|....:            |..|..|::.
Zfish     1 MVRICERRMK---------FLVAVTLIVGSVVFLLFPSETEAD------------EKKKGPKVTA 44

  Fly    66 LPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDF 130
              :|:||:...:|..||||:.|....||||.|||..|.|||||||||||.|||||.:||.|||||
Zfish    45 --KVYFDIKIGDEDAGRIVIGLFGKTVPKTTENFLQLATGEKGFGYKGSKFHRVIKDFMIQGGDF 107

  Fly   131 TNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            |..:|||||||||::||||||:|||.|.|.|||||||.:||||||||.||:|.|||.||||||::
Zfish   108 TRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKI 172

  Fly   196 VEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            :||:|||:|||:..:.. .|..|.:.:.:||.:
Zfish   173 LEGMDVVRKIEATKTDGRDKPLKDVSIHDSGKI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 98/158 (62%)
ppibNP_998184.1 cyclophilin_ABH_like 45..203 CDD:238907 98/157 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.