DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CG7768

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:163 Identity:136/163 - (83%)
Similarity:152/163 - (93%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGD 129
            :||||:||:.|..|.|||||||||||||||||||||||||||||:|||||.||||||||||||||
  Fly     2 SLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGD 66

  Fly   130 FTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGE 194
            |||.|||||:||||||||||||||||||:|:|||||||||||||||||||.||.||||||||||:
  Fly    67 FTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGK 131

  Fly   195 VVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||||:|:|:|:||||||.||||||:|:.:.|:|
  Fly   132 VVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 133/157 (85%)
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 133/157 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447222
Domainoid 1 1.000 245 1.000 Domainoid score I551
eggNOG 1 0.900 - - E1_COG0652
Homologene 1 1.000 - - H38696
Inparanoid 1 1.050 256 1.000 Inparanoid score I999
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121127at50557
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm26591
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
1312.830

Return to query results.
Submit another query.