DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppih

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_989366.1 Gene:ppih / 394997 XenbaseID:XB-GENE-485863 Length:177 Species:Xenopus tropicalis


Alignment Length:167 Identity:88/167 - (52%)
Similarity:114/167 - (68%) Gaps:6/167 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGE-----KGFGYKGSIFHRVIPNFMCQ 126
            |.||||::...:.:||:.:||.:|:|||||||||..||||     ...|||||.|||||.:||.|
 Frog    11 PIVFFDISIGGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQ 75

  Fly   127 GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVV 191
            ||||.|.:|||..|||...|.||||:.||:..|:|||||:|..|||.||||...|..|||.||||
 Frog    76 GGDFVNGDGTGVASIYRGPFADENFKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDGKHVV 140

  Fly   192 FGEVVEGLDVVKKIESYGS-QSGKTSKKIIVANSGSL 227
            ||:|::||.|::|||:..: .:.|....:::|..|.:
 Frog   141 FGKVIDGLLVMRKIENVPTGPNNKPKLPVVIAQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 87/163 (53%)
ppihNP_989366.1 cyclophilin 5..177 CDD:381853 88/165 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.