DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppia

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_988875.1 Gene:ppia / 394470 XenbaseID:XB-GENE-5778000 Length:164 Species:Xenopus tropicalis


Alignment Length:162 Identity:128/162 - (79%)
Similarity:143/162 - (88%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDF 130
            |||||||:..|..|:|||:||||||||||||||||||||.|||||||.|.|||:||.||||||||
 Frog     3 LPRVFFDIAVDGCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQGGDF 67

  Fly   131 TNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            ||||||||||||||||.||||:|:|||.|||||||||||||||||||||.||:|||.||||||.|
 Frog    68 TNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTV 132

  Fly   196 VEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ::|:|||:.:|..||||||.:|||::||.|.|
 Frog   133 IDGMDVVRNMEKLGSQSGKPAKKIVIANCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 125/157 (80%)
ppiaNP_988875.1 cyclophilin_ABH_like 4..162 CDD:238907 125/157 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm48259
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.