DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cwc27

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:116 Identity:56/116 - (48%)
Similarity:74/116 - (63%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNK 145
            |.|.:||.|...||...||..||.  :|: |.|:||||::|.|:.||||.|. .||||:||||..
Zfish    22 GDIDIELWSKETPKACRNFVQLCM--EGY-YDGTIFHRMVPEFIVQGGDPTG-TGTGGESIYGRP 82

  Fly   146 FPDE-NFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEV 195
            |.|| :..|:....|:::|||||.:.||||||....:...|:|||.:||:|
Zfish    83 FKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 56/116 (48%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 56/116 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.