DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CG8336

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:181 Identity:81/181 - (44%)
Similarity:112/181 - (61%) Gaps:9/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 REYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YK 112
            |:..:|.| ||.|.|:.|::...|..||:::|||.|||||||||||||||||.|.|       ||
  Fly     4 RKLLRAVK-STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYK 67

  Fly   113 GSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAG-ANTNGSQFF 176
            |:.||::...|:.|.||...::|:.|:||||..|.||||||.|...|::||||.| .|:|.||||
  Fly    68 GTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFF 132

  Fly   177 ICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            |.......|:..:||.|.|:.||.:|.::|...:..|..:..|::.:.|.:
  Fly   133 ISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 75/165 (45%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 75/165 (45%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447197
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.