DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CG2852

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:176 Identity:95/176 - (53%)
Similarity:130/176 - (73%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFH 117
            :|.:.||..|::  .:||||:|...||.|||.:.|....||||.|||:.|....:|.|||||.||
  Fly    17 VVADDSKGPKVT--EKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFH 79

  Fly   118 RVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKT 182
            |:|.:||.||||||..:||||:||||.:|.||||:|||.|:|.|||||||.:||||||||.|.:|
  Fly    80 RIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQT 144

  Fly   183 AWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            :|||.:|||||:::.|::||::||:..:.: .:..|.:::||||:|
  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 88/158 (56%)
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 88/157 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447215
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.