DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppid

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001004279.1 Gene:Ppid / 361967 RGDID:1303174 Length:370 Species:Rattus norvegicus


Alignment Length:180 Identity:105/180 - (58%)
Similarity:124/180 - (68%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SKASKMSTL--PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG--------YK 112
            |.|.|.|..  ||||||:....|.:||||:||.:|:|||||||||||||||||.|        :|
  Rat     5 SPAGKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFK 69

  Fly   113 GSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFI 177
            |..|||:|..||.|||||:|.|||||:||||.||.||||..||...|:|||||||.|||||||||
  Rat    70 GCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFI 134

  Fly   178 CTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            .||.|..||.||||||:|::||.|.:.:|:......|.:|..::|..|.|
  Rat   135 TTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAECGEL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 99/165 (60%)
PpidNP_001004279.1 cyclophilin_ABH_like 16..182 CDD:238907 99/165 (60%)
Chaperone activity. /evidence=ECO:0000250 185..215 105/180 (58%)
3a0801s09 192..>330 CDD:273380
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 223..251 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.