DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppial4g

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:159 Identity:107/159 - (67%)
Similarity:130/159 - (81%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNH 133
            :||::|||.|||||:.:||.:|.||:||||||:|.|||||||||||.|||:||.||||||..|.|
  Rat     6 MFFNITADGEPLGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCH 70

  Fly   134 NGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEG 198
            ||||||||||.||.:::|.|||||.|||||||||.|||||||||||.||..||.|.||||:...|
  Rat    71 NGTGGKSIYGEKFENDSFILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCVVFGKGRGG 135

  Fly   199 LDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            .::|:.:|.:||::|||||||.:::.|.|
  Rat   136 TNIVEAMEHFGSRNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 105/155 (68%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 105/154 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.