DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CG17266

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:172 Identity:86/172 - (50%)
Similarity:111/172 - (64%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGE-----KGFGYKGSIFHRVIP 121
            :.|..|.||||:......:||::.||.:|.||:||||||..||||     ...||||:.|||||.
  Fly    12 RSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIK 76

  Fly   122 NFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD 186
            :||.|||||...:|||..|||||.|.||||.|||...|:|||||:|..|||.||||...|..:||
  Fly    77 DFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLD 141

  Fly   187 NKHVVFGEVVEGLDVVKKIESYGS-QSGKTSKKIIVANSGSL 227
            .||||||.|::||.:::|||:..: .:.|....:.::..|.:
  Fly   142 GKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 84/163 (52%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 84/163 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447221
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.