DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppiaa

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_997923.1 Gene:ppiaa / 336612 ZFINID:ZDB-GENE-030131-8556 Length:164 Species:Danio rerio


Alignment Length:161 Identity:126/161 - (78%)
Similarity:142/161 - (88%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFT 131
            |:||||:||...|:||:|||||:||||:||||||.||||:.|:|||||.||||||.|||||||||
Zfish     4 PKVFFDLTAGGNPVGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFT 68

  Fly   132 NHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVV 196
            |||||||||||||||.||||.|||||:|.|||||||.|||||||||||..|:|||.||||||:||
Zfish    69 NHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQVV 133

  Fly   197 EGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            |||||:||:|.:||.|||||.|||:|:.|.|
Zfish   134 EGLDVIKKVEGFGSSSGKTSAKIIIADCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 124/157 (79%)
ppiaaNP_997923.1 cyclophilin_ABH_like 4..162 CDD:238907 124/157 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 276 1.000 Inparanoid score I2921
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm26591
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.