DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ninaA

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:209 Identity:81/209 - (38%)
Similarity:113/209 - (54%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LANKSITLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVV 92
            |.|: |.|.|:..:|..| |.|              :...|::.|:..:.:|:|||...|...:.
  Fly     4 LLNR-IILCSAFLAVASG-LSF--------------TVTSRIYMDVKHNKKPVGRITFGLFGKLA 52

  Fly    93 PKTAENFRALC-TGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDEN--FELK 154
            |||..|||.:| .|..|..|.||.||||:..|:.||||..|.:|||..||||:.||||:  ..::
  Fly    53 PKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVE 117

  Fly   155 HTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTS--- 216
            |...|.|.|||.|.:|||.||::.||...|||.||.|||:|:||:|.:..||..     ||.   
  Fly   118 HNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDV-----KTDTDD 177

  Fly   217 ---KKIIVANSGSL 227
               :.::::|.|.:
  Fly   178 FPVEPVVISNCGEI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 71/166 (43%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 71/166 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.