DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and nktr

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_001338072.4 Gene:nktr / 323005 ZFINID:ZDB-GENE-030131-1725 Length:1396 Species:Danio rerio


Alignment Length:154 Identity:86/154 - (55%)
Similarity:105/154 - (68%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG--------YKGSIFHRVIPNF 123
            |:.:||:..:.||:||||.:|.||:.|||::||..|||||||.|        ||||.||||:.||
Zfish     7 PQCYFDVEINREPVGRIVFQLFSDICPKTSKNFLCLCTGEKGSGKATGKKLCYKGSTFHRVVKNF 71

  Fly   124 MCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNK 188
            |.||||||..||.||:||:|..|.||||.|||..:.:|||||.|.:||||||||.|.....||..
Zfish    72 MIQGGDFTEGNGRGGESIFGGFFEDENFTLKHDRAFLLSMANRGKDTNGSQFFITTKTAPHLDGV 136

  Fly   189 HVVFGEVVEGLDVVKKIESYGSQS 212
            |||||.|:.|.:|:|.||...:.|
Zfish   137 HVVFGLVISGFEVIKNIEGLKTDS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 86/154 (56%)
nktrXP_001338072.4 cyclophilin 7..174 CDD:294131 86/154 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.