DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppif

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_758443.1 Gene:Ppif / 282819 RGDID:628670 Length:206 Species:Rattus norvegicus


Alignment Length:168 Identity:128/168 - (76%)
Similarity:146/168 - (86%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 124
            |:..|..|.|:.|:.||.:||||:|:||::|||||||||||||||||||||||||.||||||.||
  Rat    38 ANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFM 102

  Fly   125 CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKH 189
            ||.||||||||||||||||::||||||.|||.|.|:|||||||.|||||||||||:||.|||.||
  Rat   103 CQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKH 167

  Fly   190 VVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||||.|.||:||||||||:||:||||||||::.:.|.|
  Rat   168 VVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 124/157 (79%)
PpifNP_758443.1 cyclophilin_ABH_like 45..203 CDD:238907 124/157 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 258 1.000 Domainoid score I1934
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 1 1.050 277 1.000 Inparanoid score I2860
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm45192
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.