DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and wis2

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_594787.1 Gene:wis2 / 2542541 PomBaseID:SPAC1B3.03c Length:356 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:89/168 - (52%)
Similarity:111/168 - (66%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG----YKGSIFHRVIPNF 123
            |||.  .:|.::.|.:....|..||..:|||||.:||.:||.|.:..|    ||||.|||||.||
pombe     1 MSTY--AYFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVIKNF 63

  Fly   124 MCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNK 188
            |.||||||..|||||:||||.||.||||||||....:|||||||.|||||||||.||.|..||.|
pombe    64 MLQGGDFTRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGPNTNGSQFFITTVPTPHLDGK 128

  Fly   189 HVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGS 226
            |||||:|::|...|:.||:..:::......:::...|:
pombe   129 HVVFGKVIQGKSTVRTIENLETKNDDPVVPVVIEECGT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 85/161 (53%)
wis2NP_594787.1 cyclophilin 6..165 CDD:294131 85/158 (54%)
TPR_11 204..287 CDD:290150
TPR repeat 204..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR_11 261..323 CDD:290150
TPR repeat 293..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.