DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyp4

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_596532.1 Gene:cyp4 / 2541395 PomBaseID:SPBP8B7.25 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:106/195 - (54%)
Similarity:126/195 - (64%) Gaps:18/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAEN 98
            ||.....|.|||.                 .....|:||:...:|.|||:.:.|....|||||||
pombe    11 TLFFGLISANRGP-----------------KVTDTVYFDLQQGDEFLGRVTIGLFGKTVPKTAEN 58

  Fly    99 FRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSM 163
            ||||.||||||||:||||||||||||.||||.|..:|||||||||::||||||:|.|...|:|||
pombe    59 FRALATGEKGFGYEGSIFHRVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSM 123

  Fly   164 ANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            ||||.::|||||||.||||.|||..|||||||:.|.|:||||....:.: .|..:.:.:..||.|
pombe   124 ANAGPDSNGSQFFITTVKTPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDVKIIKSGQL 188

  Fly   228  227
            pombe   189  188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 97/158 (61%)
cyp4NP_596532.1 cyclophilin 27..186 CDD:294131 97/158 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.