DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and CG30350

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:171 Identity:44/171 - (25%)
Similarity:71/171 - (41%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDM-TADNEPLGRIVMELRSDVVPKTAENF--RALCTGEKGFGYKGSIFHRVIPNFMCQ-- 126
            ||::||: ..|..||||.|::|.::..|......  ..:|.....|..|     |:.||...:  
  Fly   213 PRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFPNLWLETD 272

  Fly   127 ---GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGAN--TNGSQFFICTVKTAWLD 186
               ..|...|....    |..|..|..     ..|.:||.:.|...  |:...|.|.......::
  Fly   273 LMLSSDSLLHQPLE----YDAKVIDHG-----ASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVN 328

  Fly   187 NKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ...|.||.:|:|..:.:.|:|||:::||.|:.::..:.|.|
  Fly   329 GSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 42/167 (25%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 43/169 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.