DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Ppic

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_032934.1 Gene:Ppic / 19038 MGIID:97751 Length:212 Species:Mus musculus


Alignment Length:165 Identity:96/165 - (58%)
Similarity:117/165 - (70%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 STLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGG 128
            |...:||||:...::.:||||:.|..:|||||.|||.||.|||||:|||||||||||.:||.|||
Mouse    35 SVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGG 99

  Fly   129 DFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFG 193
            |||..:||||.||||..||||||:|||.|.|.:||||||.:||||||||...|..|||.||||||
Mouse   100 DFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFG 164

  Fly   194 EVVEGLDVVKKIESYGSQS-GKTSKKIIVANSGSL 227
            :|::|:.||..||...:.. .:......:.|||.:
Mouse   165 KVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 93/158 (59%)
PpicNP_032934.1 cyclophilin_ABH_like 38..197 CDD:238907 93/158 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.