DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-8

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_509507.1 Gene:cyn-8 / 181136 WormBaseID:WBGene00000884 Length:447 Species:Caenorhabditis elegans


Alignment Length:181 Identity:88/181 - (48%)
Similarity:111/181 - (61%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKG------FGYKGSIFHRVIPNFMCQ 126
            |.|||::.:.||.||||..|.:...|:|.|||||.||||.|      ..|:||:|||||..||.|
 Worm    10 RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRVIKGFMIQ 74

  Fly   127 GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVV 191
            |||.|:.|||||.||||..|.|||..|||....:|||||.|.:||||||||.:.:...||.||.|
 Worm    75 GGDITHGNGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCV 139

  Fly   192 FGEVVEGLDVVKKIESYGSQSGKTSKKI----------------IVANSGS 226
            ||||::|::|||.||:.  ::|...|.:                :|.|:|:
 Worm   140 FGEVIKGVEVVKAIENL--ETGNEDKPVCKVEITHCGEMVRKGDVVGNAGA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 87/178 (49%)
cyn-8NP_509507.1 cyclophilin 10..174 CDD:412213 85/165 (52%)
ATP-synt_Fo_b <324..391 CDD:349951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.