DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-13

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001255925.1 Gene:cyn-13 / 178487 WormBaseID:WBGene00000889 Length:331 Species:Caenorhabditis elegans


Alignment Length:170 Identity:107/170 - (62%)
Similarity:130/170 - (76%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPN 122
            |.:|..:.||||:..:......:||||:|||:||.||||||||.|||||:||||:||||||:||.
 Worm   130 SSSSASTKLPRVYLGVKIGIRYIGRIVIELRTDVTPKTAENFRCLCTGERGFGYEGSIFHRIIPK 194

  Fly   123 FMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDN 187
            ||.||||||..:|||||||||.||.||||.|:||..|.:||||.|||||||||||||.||.|||.
 Worm   195 FMLQGGDFTKGDGTGGKSIYGTKFDDENFTLRHTMPGTVSMANCGANTNGSQFFICTEKTDWLDG 259

  Fly   188 KHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||||||.||||:::|:::|..|:.|||....:.:..||.:
 Worm   260 KHVVFGHVVEGMNIVRQVEQQGTPSGKPQMVVKIVESGEI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 102/157 (65%)
cyn-13NP_001255925.1 RRM <10..>115 CDD:223796
RRM_PPIE 13..85 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 102/157 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.