DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Y17G9B.4

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_500632.3 Gene:Y17G9B.4 / 177245 WormBaseID:WBGene00021201 Length:262 Species:Caenorhabditis elegans


Alignment Length:168 Identity:49/168 - (29%)
Similarity:79/168 - (47%) Gaps:21/168 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFH-------RVIPNFMCQ 126
            ||..::......|.||::|.:|:||:||:||.:.|||||. |..|...|       .::|..:..
 Worm    99 VFIHVSIGGIEEGCIVIQLFNDIVPRTAQNFESWCTGEKR-GKYGEPLHLKECEIKMILPGSVIG 162

  Fly   127 GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD--NKH 189
            .|||..:         ...|.||..:..|. ..:||| |...:.|.|........:..:|  .|.
 Worm   163 FGDFEEN---------CEYFDDEKSKENHC-KNVLSM-NIDKSENSSAPLFNMELSDGVDRAGKA 216

  Fly   190 VVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            :|||:||.|..|::|:...||:.|...:.:.:::.|.:
 Worm   217 IVFGKVVMGNRVIEKVLLAGSRDGIPEQTVKISDCGEM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 48/164 (29%)
Y17G9B.4NP_500632.3 cyclophilin 99..252 CDD:294131 48/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.